SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0249088 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0249088
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily PapD-like 1.67e-20
Family MSP-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0249088   Gene: FBgn0221942   Transcript: FBtr0250596
Sequence length 199
Comment type=protein; loc=scf2_1100000004540:70009..70608; ID=FBpp0249088; name=DwilGK19945-PA; parent=FBgn0221942,FBtr0250596; dbxref=FlyBase:FBpp0249088,FlyBase_Annotation_IDs:GK19945-PA,GB_protein:EDW76704,REFSEQ:XP_002065718,FlyMine:FBpp0249088; MD5=cb137f34e30ea816de9e83e97535c3b7; length=199; release=r1.3; species=Dwil;
Sequence
MKTTSPRLFFVRPNIGILDPKQQVSVEIYVQPVHLRPDMQQKRHKFLIMAAEALPDVEMS
NLQDFWKMQKPDDIWDTKLKCFMLANKDERVREAGGGSEPLSLPQIKSMPEPASAVGQNG
QDDKQETGGAAALMDDGSLQEKCQQLGAKATLNHLNTITPVSVSADSSLKGRQFFYAMAF
MIALLAAIVVAFAAGQLHI
Download sequence
Identical sequences 7260.FBpp0249088 FBpp0249088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]