SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0250093 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0250093
Domain Number 1 Region: 80-419
Classification Level Classification E-value
Superfamily TPR-like 5.06e-34
Family Tetratricopeptide repeat (TPR) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0250093   Gene: FBgn0222942   Transcript: FBtr0251601
Sequence length 487
Comment type=protein; loc=scf2_1100000004510:join(3359361..3359439,3359547..3359686,3359815..3359927,3360821..3361111,3361230..3361386,3361462..3361584,3361658..3361742,3362547..3362633,3362753..3362967,3363052..3363225); ID=FBpp0250093; name=DwilGK20950-PA; parent=FBgn0222942,FBtr0251601; dbxref=FlyBase:FBpp0250093,FlyBase_Annotation_IDs:GK20950-PA,GB_protein:EDW72517,REFSEQ:XP_002061531,FlyMine:FBpp0250093; MD5=ff4a11cc1a5d54ce634b3133093c6990; length=487; release=r1.3; species=Dwil;
Sequence
MYEPGSEQINCNGHIIDLPSLEVVKTAPKMPGDANIDWLLHIYFTRREFKRCRRLIEREL
NRHLNPEYLYFVQGLIDREEGNNIEALRNLQKSVELNSKNTETYKEIGRTLYLMGRFAQA
LNVFREAEQLSPRQDHEIYHYLGELLYRAAATQTKREVARQQLAESRSYFEMSIQSGKKL
ESFMRLAELYRKEKEYQMAIDVLETCLHLTPENAEVLTEISVLYLKINETQKAYDRLQEV
VNIERKCQPKGLLAFGAILQSRNDIDGALSKYSQIANAEPEIAELWNNIGLCFFKKQKFI
VAISSLRKSVWLSPLNYNALYNLSLIYIASEQYASAFHTLAAAINLRKDNAECYMLLGLC
LRKLDDMENAFNAFERAGNVILAFPANSTRNPLIFLNYALFCYETGRLALATEQYNRFLS
QAQDLMLPTEYKYQATKLKSLLRITSNGNGILLDASENDIRISEHTNGLQQTDDLPLEVN
AVVNNQN
Download sequence
Identical sequences B4MK78
7260.FBpp0250093 XP_002061531.1.14588 FBpp0250093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]