SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0251284 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0251284
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.24e-48
Family Calponin-homology domain, CH-domain 0.00000051
Further Details:      
 
Domain Number 2 Region: 298-361
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 2.88e-21
Family EB1 dimerisation domain-like 0.00021
Further Details:      
 
Domain Number 3 Region: 164-208
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000208
Family Calponin-homology domain, CH-domain 0.00024
Further Details:      
 
Weak hits

Sequence:  FBpp0251284
Domain Number - Region: 242-298
Classification Level Classification E-value
Superfamily Connexin43 0.0275
Family Connexin43 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0251284   Gene: FBgn0224126   Transcript: FBtr0252792
Sequence length 373
Comment type=protein; loc=scf2_1100000004558:complement(160794..160917,161471..161553,161620..161759,162161..162434,163771..164004,164405..164550,164623..164743); ID=FBpp0251284; name=DwilGK22141-PA; parent=FBgn0224126,FBtr0252792; dbxref=FlyBase:FBpp0251284,FlyBase_Annotation_IDs:GK22141-PA,GB_protein:EDW77035,REFSEQ:XP_002066049,FlyMine:FBpp0251284; MD5=18d0af91f7978223a26317ccebd7d000; length=373; release=r1.3; species=Dwil;
Sequence
MAVNVYSTNVTSENLSRHDMLAWVNDCLQSNFSKIEELCTGAAYCQFMDMLFPNSVPVKR
VKFRTNLEHEYIQNFKILQAGFKKMSVDKIIPVDKLIKGRFQDNFEFLQWFKKFFDANYD
GREYDPVAQRGNIKLGNGDANSSNGGSGVGSTNNDLHLMHRRPMPTAIIPIDKLIKGRFQ
DNFEFLQWFKKFFDANYDGRDYDASAVREGAPMGFGSGAVKSLPGTGGGGSGIGSTYNRR
VPTSSAATSRPAPAATKPISKVPPRTNNATPPSRLTSNANHHTGAVKKNDSNAASNQQIE
ELSNQVMDMRLNLEGLEKERDFYFSKLRDIEILCQEADDGETHPLIQKILDILYATEDGF
APPDDAPPEDEEY
Download sequence
Identical sequences FBpp0251284 7260.FBpp0251284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]