SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0252847 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0252847
Domain Number 1 Region: 24-403
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-57
Family L-arabinose binding protein-like 0.0038
Further Details:      
 
Domain Number 2 Region: 453-566,683-796
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-51
Family Phosphate binding protein-like 0.00000156
Further Details:      
 
Domain Number 3 Region: 563-665
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000209
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0252847   Gene: FBgn0225666   Transcript: FBtr0254355
Sequence length 982
Comment type=protein; loc=scf2_1100000004516:complement(3908584..3908922,3908983..3909239,3909295..3909467,3909840..3910268,3910482..3910694,3910763..3910955,3911011..3911227,3911291..3911557,3911619..3911784,3911865..3912067,3912139..3912363,3912920..3913042,3913116..3913259); ID=FBpp0252847; name=DwilGK23704-PA; parent=FBgn0225666,FBtr0254355; dbxref=FlyBase:FBpp0252847,FlyBase_Annotation_IDs:GK23704-PA,GB_protein:EDW75672,REFSEQ:XP_002064686,FlyMine:FBpp0252847; MD5=ed0b27471d5f9c6b0ac609c376355fe8; length=982; release=r1.3; species=Dwil;
Sequence
MAFAVWFLSTFVIVAAQRHMALEHEGTYNIGGVLTNSDSEEHFRTTIAHLNFDQQYVPRK
VTYYEKTIRMDKNPIKTVFNVCNKLIEKRVYAVVVSHEQTSGDLSPAAVSYTSGFYSIPV
IGISSRDAAFSDKNIHVSFLRTVPPYYHQADVWLEMLSHFSYTKVIIIHSSDTDGRAILG
RFQTTSQTYYDDVDVRATVEMIVEFEPKLTSFSEHLTYMKTAQSRVYLMYASTEDAQIIF
RDARDHNMTQEGHVWIVTEQALFANNTPEGVLGLQLEHAHSDKGHIRDSVYVLASAIKEM
ISNETIAEAPKDCGDSAVNWESGKRLFQYLKTRNITGETGQVAFDDNGDRIYAGYDVINI
RENQKQHVVGKFSYDNMRAKMRMKINDSEIIWAGKQKRKPEGIMIPTHLKLLTIEEKPFV
YVRRMGDDEFHCEPNERPCPLFNTTDATANEFCCSGYCIDLLIELAKRINFTYDLALSPD
GQFGHYILRNNTGATLRKEWTGLIGQLVNERADMIVAPLTINPERAEYIEFSKPFKYQGI
TILEKKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFKLSHSDSNE
EKALNLSSAVWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVL
ERPKTKLSGINDARLRNTMENLTCATVKGSSVDMYFRRQVELSNMYRTMEANNYATAEHA
IQDVKKGKLMAFIWDSSRLEYEASKDCELVTAGELFGRSGYGIGLQKGSPWTDAVTLAIL
EFHESGFMEKLDKQWIFHGHVQQNCELFEKTPNTLGLKNMAGVFILVGVGIAGGVGLIII
EVIYKKHQVKKQKRLDIARHAADKWRGTIEKRKTIRASLAMQRQYNVGLNSRAPGTISLA
VDKKRYPRLSQRMGPERAWPGDAAEVLRMRRPYEIGKPGQSPKVIGGPPHPMLGKTRPQA
QQNLLPPRYSPGYTSDVSHLVV
Download sequence
Identical sequences B4MU83
XP_002064686.1.14588 7260.FBpp0252847 FBpp0252847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]