SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0252976 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0252976
Domain Number 1 Region: 246-406
Classification Level Classification E-value
Superfamily TPR-like 7.05e-16
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Weak hits

Sequence:  FBpp0252976
Domain Number - Region: 118-203
Classification Level Classification E-value
Superfamily TPR-like 0.0506
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0252976   Gene: FBgn0225795   Transcript: FBtr0254484
Sequence length 488
Comment type=protein; loc=scf2_1100000004516:complement(50084..50570,50634..50829,50888..51671); ID=FBpp0252976; name=DwilGK23833-PA; parent=FBgn0225795,FBtr0254484; dbxref=FlyBase:FBpp0252976,FlyBase_Annotation_IDs:GK23833-PA,GB_protein:EDW75409,REFSEQ:XP_002064423,FlyMine:FBpp0252976; MD5=d348c368fc11d81527f243ff3ec7b221; length=488; release=r1.3; species=Dwil;
Sequence
MSKRQQERQRLQRKVRANLPHRTFREIKFDRDEIRQTIEPLSYNEARRQRGPIYEALEDE
LYREGCRQLPEFLRCLADKEKTLYESVIIRDRISDDRPLLYAVIDKLKEAELAYIRDKHK
SFKQSFTLFYETMLLLEPYKQKYEYALNAIMENLVSLCHKTQGQERDAAEMIARIYFTYG
EYLERMQQRVNAISYLQITIDLVRGHVWTAVRDMPPGSFTLHELVAQKLARQLLLYGKQI
VRHQPEEAIALARRATILVAEIGRQQNLDIFCETFMERAYFLMESSNYHGAHQCLEQIRP
TVIACTEYRFVKLNIKFYLLAGQCAENFENPDKAISSYKKALRLSRLYNDQKSEANILLH
LGKIFAKDTQKLCLAKKCYEQAKHIYIDFNDMISKKMVNYLLAKLMADEITPLYMAMLKA
STKQYCAFFNLRQWKNRCRPFWKKLGDEIKKQESEDIYCLLDEEKPDPSREESGFPNEDR
HFFKVEDS
Download sequence
Identical sequences B4MTH0
FBpp0252976 XP_002064423.1.14588 7260.FBpp0252976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]