SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0253716 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0253716
Domain Number 1 Region: 475-823
Classification Level Classification E-value
Superfamily TPR-like 1.46e-38
Family Tetratricopeptide repeat (TPR) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0253716   Gene: FBgn0226533   Transcript: FBtr0255224
Sequence length 833
Comment type=protein; loc=scf2_1100000004585:join(1431609..1431721,1441848..1442373,1444795..1445638,1445708..1445822,1453655..1454132,1454192..1454276,1454340..1454680); ID=FBpp0253716; name=DwilGK24573-PA; parent=FBgn0226533,FBtr0255224; dbxref=FlyBase:FBpp0253716,FlyBase_Annotation_IDs:GK24573-PA,GB_protein:EDW77572,REFSEQ:XP_002066586,FlyMine:FBpp0253716; MD5=4e7ae5e79e31a9ea4103a5f0113295ed; length=833; release=r1.3; species=Dwil;
Sequence
MDRRQKDTHYKGHLAGCSALAFVLYLNTLNAGFVYDDRRAILGNADVTGVSPFSLSQLLQ
HDYWGTELTDSGSHGSWRPLCVLSFRLNFLLGGGYHLINVLLHCLATLLVVLVARTLLPT
RSGILATGLVFASHPIHTEAVAGLVGRADLAACVCYLLTYLAYRRHMQKRDARSLVLTLL
LAMMGLLCKETAITALLLCGMCDVLMARKYEDKHRLRSLSILSISLASFLYCRLNVLPRP
GTAFASADNPTAHEPCWWSRTLTFFHLPVVNFQLLLWPQRLSFDWGMDAVVRIRSLWDAR
NLLTIGFYATLMTIIWKSLKLEASTRMDYMAMADISLPLLKRLGGHSCLGWQGHSCSCHY
QLDLYRYSSNQRLAKEATKPNDSPSSVTLPSLAPLVALSFLVLPFLPATNMLFYVGFVVA
ERLLYLPSVGYCLIFGYGFGQLWQRKHFDCGKILLLCCLSIIVGAFSLRTIQRNSDWRNE
EELYRSAIHINPPKALGNLGSILSSQGRYDEAKLVLEAAIRHRSTMADAHFNLGIVHQQQ
QNFTAALPCYRRAIQLRPQLAAAYLNLAASLQALGQHQEAISVLQMGIRLPGHAVRDRLG
HEKARRSASLQLSLLYTKENQSQLAIKILNEGLTKFKDMPKEERASFHLKLGEIYVELGQ
WQQAQVEQRLAMEAQPRHGATYTTFGQTLAKNSSRYGEAELWFKRAIQLSPLEPSVHHHY
ADFLEQQERHRESLTQRLNAVALAPNNYVLHAAVADAMRLLKRLPEAELWYRKAVNLQPR
AAHAHANLGAILQMRGQQQQAVDCYRMALKLQPGHAISRANLAKMNVNIDTNT
Download sequence
Identical sequences B4N0F9
FBpp0253716 XP_002066586.1.14588 7260.FBpp0253716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]