SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0253815 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0253815
Domain Number 1 Region: 892-1024
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000021
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0253815   Gene: FBgn0226632   Transcript: FBtr0255323
Sequence length 1066
Comment type=protein; loc=scf2_1100000004585:join(3812732..3814067,3814123..3814592,3814646..3814974,3815158..3815677,3815730..3815999,3816064..3816213,3816269..3816394); ID=FBpp0253815; name=DwilGK24672-PA; parent=FBgn0226632,FBtr0255323; dbxref=FlyBase:FBpp0253815,FlyBase_Annotation_IDs:GK24672-PA,GB_protein:EDW77786,REFSEQ:XP_002066800,FlyMine:FBpp0253815; MD5=e10cccaee14b660d75cb7fc6e7736d47; length=1066; release=r1.3; species=Dwil;
Sequence
MDTKNNGTTTTVRRTSRPLRKKRSSYRQSRRSTFDSEQSGDLLGPEKRISQQRVFLYIQL
NVIDKLPETAYPMELHLFHVKNTLQKMQEKYTKDTIIYQNEFSMNKPVFAMGIMQDDIND
MNTFSDNPLVITLYQRIPRHRKGHMKTINMSFNAKCDGADYTASTSSTTQMDGIPDQNFS
KTTGNSESVEAEGESEQGNQVGERLQFISRGNCDLLQLFQRRRFISNVEIFLYPQYKRLL
RTPTSEKITTSTQWHMYSILPMLKNFNFNNLVFITLESIYNVPDDLHERAADLGVSIAFR
SKLPKENGDYHVLPICNYYSFSSQIISTQSTGIVWENIKRDYNPSKNFSSLQMETNMRIK
LPHIFRQLLATPGVDLKLDQIDPLVDVALINNSLHRFVLTEEMRLILESAISQNDYDLVV
QLFKDTPENAFYEGVINPSIFVYPSVNNCRFATLLTPIFRPSVTRRTSIQNSTSSFTTNP
SIGPMFASIKICFYQPITQRNEALDTYNESVLKTSKLRRCYDLQDIRSDCEEDKNVVEEL
YRAFDNLISDVTAFIVNREIKSVEQKRDYFCCQLGNLNNILLKLCGADFNIRMPTKNNIE
FREMITHMYKELIDRIENQFDNCSWENVCHCVTAYEKEQKRLIGMMNELRMMCIIGEPEM
AKQIYEELKAGSNNQMFFNFYTFLNNVENLNFHSAAQFFLKTTDGSQDEYFPSLAKLYVN
YMMDLQSKDEEIVSAAYSNMLENLRIFADKHSLDMDIWILLYCYYKSHEYLPGMEYARWK
YENLCDVPAKTLSNTPRSLYELFLPNDFEISNSAGKTNLKFYQTFKLFARLGAYGFAEIV
FAQISEDFTPVEAYLVTTTLKTLQGQIDDEFQIHQLDTDNNDQLMHYYQAHVNGNALYSR
GSFDEAIVQFKDLLNITEPNVGCIFEISLMRLAHLAFEREDYELASQAFEMCLPSDNKPK
KHFMANYGKALALYYMNHLEEATEYLAKCTEVEVFMPDIWGYLAIINLRMNRNKRALDCW
KMAKMYPEIELNNHIYEELEKIKFTDLHLLVDDDGNPAETVTFQIF
Download sequence
Identical sequences B4MZK1
XP_002066800.1.14588 FBpp0253815 7260.FBpp0253815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]