SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0254196 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0254196
Domain Number 1 Region: 247-573
Classification Level Classification E-value
Superfamily TPR-like 5.25e-98
Family Tetratricopeptide repeat (TPR) 0.000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0254196   Gene: FBgn0227012   Transcript: FBtr0255704
Sequence length 574
Comment type=protein; loc=scf2_1100000004909:complement(9186187..9187911); ID=FBpp0254196; name=DwilGK25053-PA; parent=FBgn0227012,FBtr0255704; dbxref=FlyBase:FBpp0254196,FlyBase_Annotation_IDs:GK25053-PA,GB_protein:EDW82588,REFSEQ:XP_002071602,FlyMine:FBpp0254196; MD5=4b70a6467c83c04a5833748a15dec814; length=574; release=r1.3; species=Dwil;
Sequence
MSSLRPLVEGDCGGVNPLMQLGGQFTRDVAHKDEGFVQRQFERGMRPEDQLINEFLGQVA
APAQSFQMDTLLQEMRDINIHSHGGLQQQQQQQQLQLQHQQQAAQWSQDFAQGMAPPVLS
NKIINMQPQHQQMQHVQEFFDDGPLIRVENFAMRPQPGHYLPPMQQQQDNQFFDPNMETI
STDNLPRAPQGESLEDWITDYQRSTEQKEQASANFNEKFWQRLQDEWQKLAEENEHPWLS
EYNENLDNYKEYEFAEENPMSELDNAFEKGKEYLTKGDIPSAVLCFEVAAKKEPERAEIW
ELLGISQAENEMDPQSIAALKRALELQPDNRRVIMALAVCYTNEGLQYNAVKMLSNWLEV
HPAYTQLLQSHPDLKSDGAYLASSLIGPKKLQDLQQVYLEAVRLRLPEVDPDVQEALGVL
YNLSGEFDKAVDCYQAALQVDPQNAKVWNRLGASLANGSRSVEAVEAYQQALQLQPGFIR
VRYNVGVCCMNLKAYKEAVEHLLTALTMQAHTNAVRELPNVAAGGGPSLSGNQNQMSDSI
WSTVKMVISLMGRSDLQVHVSDRNLQALNEAFKD
Download sequence
Identical sequences B4NCM9
XP_002071602.1.14588 7260.FBpp0254196 FBpp0254196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]