SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0255009 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0255009
Domain Number 1 Region: 209-352
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-42
Family Third domain of FERM 0.0000055
Further Details:      
 
Domain Number 2 Region: 101-208
Classification Level Classification E-value
Superfamily Second domain of FERM 6.67e-31
Family Second domain of FERM 0.00000877
Further Details:      
 
Domain Number 3 Region: 553-636
Classification Level Classification E-value
Superfamily Moesin tail domain 1.31e-23
Family Moesin tail domain 0.0016
Further Details:      
 
Domain Number 4 Region: 9-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-23
Family First domain of FERM 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0255009   Gene: FBgn0227825   Transcript: FBtr0256517
Sequence length 636
Comment type=protein; loc=scf2_1100000004909:join(8912673..8913226,8913293..8913395,8913466..8913675,8913745..8913981,8914211..8915017); ID=FBpp0255009; name=DwilGK25866-PA; parent=FBgn0227825,FBtr0256517; dbxref=FlyBase:FBpp0255009,FlyBase_Annotation_IDs:GK25866-PA,GB_protein:EDW82553,REFSEQ:XP_002071567,FlyMine:FBpp0255009; MD5=525c9be16b2367c74a10fe5b8db64100; length=636; release=r1.3; species=Dwil;
Sequence
MSPFGSKKNRSLPVRVSTFDSELEFDLEPRASGQDLFDLVCRTIGLRESWYFGLQYVDTR
SNVSWLKMDKKVKDQRIELHANNNFYIFSFYAKYFPENVSEELIQEITQHLFFLQVKQSI
LSMDIYCRPEASVLLASYAVHVQYGPYDYESYKDGMLAGGELLPKGVTDQYQMTPEMWEE
RIKTWYMDHEPMTRDEVEMEYLKIAQDLDMYGVNYFPITNKNKTKLWLGVTAVGLNIYDE
RDKLTPKTTFQWNEIRHVSFDDKKFTIRLVDAKVSNFIFYSQDLHINKMILDLCKGNHDL
YMRRRKPDTMEIQQMKAQAKEEKQRRQIERKKFIREKKLREKAEHERYELEKRLEHLQDE
MRMASDALRRSEETKELYFEKSRVNEEQMQLTECKANHFKTEMDRLRERQMKIEREKHDL
EKKIRDADFYVHQLTVENDKREAETEKLKKELICAKMAEREATARLLNFLNSGRKSSTDS
LLTASTVSNAVNNASSIAAISTPSLTTSSSTNDMVTVGGADLTITHPYHLVMGDNSSGIS
DDFEPKEFILTGNEMEQITNEMESNHLEYLRKTKNQVQNQLQTLRSEIAPHKIEENQSNF
DILSEAQIKAGENKYSTLKKLKSGSTKARVAFFEEL
Download sequence
Identical sequences B4NCJ4
XP_002071567.1.14588 7260.FBpp0255009 FBpp0255009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]