SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000054 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000054
Domain Number 1 Region: 75-131
Classification Level Classification E-value
Superfamily Kringle-like 1.34e-16
Family Fibronectin type II module 0.0052
Further Details:      
 
Domain Number 2 Region: 44-87
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000248
Family Fibronectin type II module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000054   Gene: ENSGGOG00000000055   Transcript: ENSGGOT00000000055
Sequence length 132
Comment pep:known_by_projection chromosome:gorGor3.1:19:45218079:45244725:-1 gene:ENSGGOG00000000055 transcript:ENSGGOT00000000055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLMLLFVETTRNSSACIFPVILSISFSFSETITHFPEVKDGECVFPFHYKNGTYYDCI
KSKARHKWCSLNKTYEGYWKFCSAEDFANCAFPFWYRRLIYWECTDDGEAFGKKWCSLTK
NFNKDRIWKYCE
Download sequence
Identical sequences ENSGGOP00000027087 ENSGGOP00000000054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]