SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000100 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000100
Domain Number 1 Region: 99-193
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000992
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 
Domain Number 2 Region: 224-261
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000339
Family I set domains 0.094
Further Details:      
 
Domain Number 3 Region: 304-375
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000666
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000100   Gene: ENSGGOG00000000101   Transcript: ENSGGOT00000000102
Sequence length 397
Comment pep:known_by_projection chromosome:gorGor3.1:19:48821258:48827958:1 gene:ENSGGOG00000000101 transcript:ENSGGOT00000000102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVFGCPTPAGQSPPWGGKAALKAGRRGRQPLCQETQVLEGAEEVAVSLEGPLLLEDPRQ
LMDLSRPRWSLRRRIFLMASLLACGICQASGQIFITQTLGIKGYRTVLALDNVPEDVQEY
SWYWGANDNAGNMIISHKPPSAQQPGPMYTGRERVNREGSLLIRPTALNDTGNYTVRVVA
GNETQRATGWLEVLELGSNPGISVNASSLVENMDSVAADCHTNVTNITWYVNDVPTSSSD
RMTISPDGKTLVILRVSRHDRTIQCMIESFPEIFQRSERISLTVAYGRDYVLLRSNPDDF
NGIVTAEIGSQVEMECICYSFLDLKYHWIHNGSLLNFSDAKMNLSSLAWEQMGRRCTVEN
PVTQLIMYMDVRIQAPRECSSSRPGSCSAHLPASMPC
Download sequence
Identical sequences ENSGGOP00000000100 ENSGGOP00000000100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]