SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000101 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000101
Domain Number 1 Region: 153-268
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-24
Family V set domains (antibody variable domain-like) 0.0000307
Further Details:      
 
Domain Number 2 Region: 23-142
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-24
Family V set domains (antibody variable domain-like) 0.00000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000101   Gene: ENSGGOG00000000102   Transcript: ENSGGOT00000000103
Sequence length 269
Comment pep:novel chromosome:gorGor3.1:19:48844255:48846130:-1 gene:ENSGGOG00000000102 transcript:ENSGGOT00000000103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLVLLLLPPLLCGRVGAKEQKDYLLTMQKSVTVQEGLCVSVLCSFSYPQNGWTDSDPVH
GYWFRAGDHVSRNVPVATNNPARAVQEETRDRFHLLGDPQNKDCTLSIRDTRESDAGTYV
FRVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESVTVQEGLCVSVPCSVLYPHYNW
TASSPVYGSWFKEGADIPWDIPVATNTPGGKVQEDTQGRFLLLGGPQTNNCSLSIRDARK
GDSGKYYFQVERGSRKWNYIYDKLSVHVT
Download sequence
Identical sequences ENSGGOP00000000101 ENSGGOP00000000101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]