SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000110 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000110
Domain Number 1 Region: 682-743
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000575
Family VWC domain 0.0043
Further Details:      
 
Domain Number 2 Region: 761-830
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000418
Family VWC domain 0.06
Further Details:      
 
Domain Number 3 Region: 25-107
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000711
Family VWC domain 0.021
Further Details:      
 
Domain Number 4 Region: 849-912
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000209
Family VWC domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000110   Gene: ENSGGOG00000000110   Transcript: ENSGGOT00000000112
Sequence length 934
Comment pep:known_by_projection chromosome:gorGor3.1:3:185748288:185757223:1 gene:ENSGGOG00000000110 transcript:ENSGGOT00000000112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPGTRGQPPGRHTARAGQRPPAKPVPAGCSFGGKVYALDETWHPDLGEPFGVMRCVLCA
CEAQPQWGRRTRGPGRVSCKNIKPECPTPACGQPRQLPGHCCQTCPQERSSSERQPSGLS
FEYPRDPEHRSYSDRGEPGAEERARGDGHTDFVALLTGPRSQAVARARVSLLRSSLRFSI
SYRRLDRPTRVRFSDSNGSVLFEHPAAPTQDGLVCGVWRAVPRLSLRLLRAEQLHVALVT
LTHPSGEVWGPLIRHRALAAETFSAILTLEGPPQQGVGGITLLTLSDTEDSLHFLLLFRG
LLEPRSGGLTQVPLRLQILHQGQLLRELQANVSAQEPGFAEVLPNLTVQEMDWLVLGELQ
MALEWAGRPGLRISGHIAARKSCDVLQSVLCGADALIPVQTGAAGSASLTLLGNGSLIYQ
VQVVGTSSEVVAMTLETKPQRRDQRTVLCHMAGLQPGGHMAVGICPGLGARGAHMLLQNE
LFLNVGTKDFPDGELRGHVAALPYCGHSARHDTLPVPLAGALVLPPVKSQAAGHAWLSLD
THCHLHYEVLLAGLGGSEQGTVTAHLLGPPGTPGPRRLLKGFYGSEAQGVVKDLEPELLR
HLAKGMASLLITTKGSPRGELRGQVHIANQCEVGGLRLEAAGAEGVRALGGPGYSCWCAA
CGGLPALAPAKPGGPGRPRDPNTCFFEGQQRPHGARWAPNYDPLCSLCTCQRRTVICDPV
VCPPPSCPHPVQAPDQCCPVCPEKQDVRDLPGLPRSRDPGEGCYFDGDRSWRAAGTRWHP
VVPPFGLIKCAVCTCKGGTGEVHCEKVQCPRLACAQPVRVNPTDCCKQCPVGSGAHPQLG
DPMQADGPRGCRFAGQWFPESQSWHPSVPPFGEMSCITCRCGAGVPHCERDDCSLPLSCG
SGKESRCCSRCTAHRRPAPETRTDPELEKEAEGS
Download sequence
Identical sequences ENSGGOP00000000110 ENSGGOP00000000110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]