SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000112 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000112
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-24
Family Phosphate binding protein-like 0.000000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000112   Gene: ENSGGOG00000000114   Transcript: ENSGGOT00000000114
Sequence length 181
Comment pep:novel chromosome:gorGor3.1:6:101924216:101944935:1 gene:ENSGGOG00000000114 transcript:ENSGGOT00000000114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLQKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNL
TQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEA
SALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKKDSWSPLIKNEVLYTIWV
N
Download sequence
Identical sequences ENSGGOP00000000112 ENSGGOP00000000112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]