SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000145 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000145
Domain Number 1 Region: 41-142
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000473
Family I set domains 0.04
Further Details:      
 
Domain Number 2 Region: 146-239
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000139
Family V set domains (antibody variable domain-like) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000145   Gene: ENSGGOG00000000146   Transcript: ENSGGOT00000000147
Sequence length 405
Comment pep:known_by_projection chromosome:gorGor3.1:21:28300304:28360639:1 gene:ENSGGOG00000000146 transcript:ENSGGOT00000000147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKERSTADTLPDLEEWKSAAGLRWWQTAVVDGSGSGNEVIEGPQNATVLKGSQARFNC
TVSQGWKHIMWALNDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVEPSDSGN
IRCSLQNSRLHGSAYLTVQVMGELFIPSVNLVVAENEPCEVTCLASHWTRLPDISWELGL
LVSHSSYYFVPEPSDLQSAVSILALTPQSNGTLTCMATWKSLKARKSATVNLTVIRRPQD
TGGGINIPGVLSSLPSLGFSLPTWGKVGLGVAGTMLLTLTCALTIRCCCCRRCGCDCCCR
CCFCCRRKRGFHIQFQKKSEKEKTNKETETESGNENSGYNSDEQKTTETASLPPKSCESS
DPEQRNSSCGPPRQRADQCPPRPASHPQASFNLASPEKVSNTTVV
Download sequence
Identical sequences G3QD41
ENSGGOP00000000145 ENSGGOP00000000145 XP_004062874.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]