SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000198 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000198
Domain Number 1 Region: 293-351
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000000818
Family BSTI 0.098
Further Details:      
 
Domain Number 2 Region: 660-720
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000126
Family BSTI 0.022
Further Details:      
 
Domain Number 3 Region: 760-823
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000134
Family ATI-like 0.014
Further Details:      
 
Domain Number 4 Region: 344-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000262
Family VWC domain 0.064
Further Details:      
 
Domain Number 5 Region: 822-864
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000994
Family VWC domain 0.038
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000198
Domain Number - Region: 1133-1189
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000948
Family BSTI 0.04
Further Details:      
 
Domain Number - Region: 712-754
Classification Level Classification E-value
Superfamily FnI-like domain 0.00324
Family Fibronectin type I module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000198   Gene: ENSGGOG00000000201   Transcript: ENSGGOT00000000203
Sequence length 1512
Comment pep:novel chromosome:gorGor3.1:11:1035926:1059245:1 gene:ENSGGOG00000000201 transcript:ENSGGOT00000000203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGDFHYKTFDGDVFRFPGLCD
YNFASDCRGSYREFAVHLKRGPGQAEAPAGVESILLTIRDDTIYLTRHLAVLNGAMVSTP
HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE
FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
VPLEPYLRACQQNRCRCPGGDTCICSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLV
YLENGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLY
TPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG
DHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTA
SFSVFRPSSYHIMVSMAIGIRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFK
TASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGR
CHSAVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACSAKGVMLWGWREHVCNKDVGS
CPDSQVFLYNLTTCQQTCRSLSEAEADSHCLQGFAPVDGCGCPDHTFLDEKGRCVPLAKC
SCYHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSR
PRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVD
CNTCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLG
SFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYL
VVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFG
NSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHD
SCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCG
NRSFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPP
GASVPTEEICKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICST
TTRPSTPTPSTVLSTTPTLSSLALHSGFLAMTELCCLWSDWINEDHPSSGSDGGDRETFD
GVCGAPEDIECRSVEDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGQFGLCYDYKIRVN
CCWPMDKCITTPSPPTTTPSPPPTSTTTLPPPESSTPQTSRSTSSPVMESTTLLSTLPPA
TETTSTAPPSTPTAPTTTRGAHTLSPPPSTTTSPPAPTPTPSKSTPTPSKPSPTPSKPSP
TPSKPTPSTKPP
Download sequence
Identical sequences ENSGGOP00000000198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]