SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000221 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000221
Domain Number 1 Region: 153-301
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-38
Family Dual specificity phosphatase-like 0.0000663
Further Details:      
 
Domain Number 2 Region: 9-141
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.58e-23
Family Cell cycle control phosphatase, catalytic domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000221   Gene: ENSGGOG00000000224   Transcript: ENSGGOT00000000226
Sequence length 536
Comment pep:novel chromosome:gorGor3.1:11:1513591:1522894:-1 gene:ENSGGOG00000000224 transcript:ENSGGOT00000000226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDRLPRKVMDAKKLASLLRGGPGGPLVIDSRSFVEYNSWHVLSSVNICCSKLVKRRLQ
QGKVTIAELIQPAARSQVEATEPQDVVVYDQSTRDASVLAADSFLSILLSKLDGCFDSVA
ILTGGFATFSSCFPGLCEGKPAALLPMSLSQPCLPVPSVGLTRILPHLYLGSQKDVLNKD
LMTQNGISYVLNASNSCPKPDFICESRFMRVPINDNYCEKLLPWLDKSIEFIDKAKLSSC
QVIVHCLAGISRSATIAIAYIMKTMGMSSDDAYRFVKDRRPSISPNFNFLGQLLEYERSL
KLLAALQGDPGTPSGTPEPPPSPVAGAPLPRLPPPTSESAATGNAAAREGGLSAGGEPPA
PPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRPDGLPGPGQPAGA
WAPPLDSPGTPSPDGPCFSPEGAQGAGGVLFAPFGRAGAPGRGGGSDLRRPEAARAESRD
ARTSWPDEPPETQIKRCSCQMEFEEGILEGRTRGEELAAMGKQASFSGSVEVIEVS
Download sequence
Identical sequences ENSGGOP00000000221 ENSGGOP00000000221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]