SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000228 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000000228
Domain Number - Region: 251-293
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0327
Family Frizzled cysteine-rich domain 0.01
Further Details:      
 
Domain Number - Region: 319-408
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0366
Family Hemolysin E (HlyE, ClyA, SheA) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000228   Gene: ENSGGOG00000000230   Transcript: ENSGGOT00000000233
Sequence length 556
Comment pep:known_by_projection chromosome:gorGor3.1:X:130828923:130943858:-1 gene:ENSGGOG00000000230 transcript:ENSGGOT00000000233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFGLPALLCTLAVLSAALLAAELKSKSCSEVRRLYVSKGFNKNDAPLHEINGDHLKIC
PQGSTCCSQEMEEKYSLQSKDDFKSVVSEQCNHLQAVFASRYKKFDEFFKELLENAEKSL
NDMFVKTYGHLYMQNSELFKDLFVELKRYYVVGNVNLEEMLNDFWARLLERMFRLVNSQY
HFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVAGDVVSKVSVVNP
TAQCTHALLKMIYCSHCRGLVTVKPCYNYCSNIMRGCLANQGDLDFEWNNFIDAMLMVAE
RLEGPFNIESVMDPIDVKISDAIMNMQDNSVQVSQKVFQGCGPPKPLPAGRISRSISESA
FSARFRPHHPEERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPNNVCNDERMAAGNGNE
DDCWNGKGKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMALRVMTSKMKNAYN
GNDVDFFDISDESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYL
LTVFCLLFLVMQREWR
Download sequence
Identical sequences G3QDB7
ENSGGOP00000000228 XP_004064933.1.27298 ENSGGOP00000000228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]