SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000277 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000000277
Domain Number - Region: 4-37
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0118
Family NlpC/P60 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000277   Gene: ENSGGOG00000000281   Transcript: ENSGGOT00000000283
Sequence length 164
Comment pep:known_by_projection chromosome:gorGor3.1:11:60342376:60352037:1 gene:ENSGGOG00000000281 transcript:ENSGGOT00000000283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEV
KRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQL
RYGKSRCKQVEKAKVEVGVATALGILVIAGCSFVIRRYQKKATA
Download sequence
Identical sequences G3QDF9
ENSGGOP00000000277 ENSGGOP00000000277 XP_004051454.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]