SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000287 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000287
Domain Number 1 Region: 143-221
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000562
Family C1 set domains (antibody constant domain-like) 0.05
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000287
Domain Number - Region: 88-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0035
Family V set domains (antibody variable domain-like) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000287   Gene: ENSGGOG00000000291   Transcript: ENSGGOT00000000293
Sequence length 335
Comment pep:known_by_projection chromosome:gorGor3.1:1:139678837:139716036:-1 gene:ENSGGOG00000000291 transcript:ENSGGOT00000000293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPKGLLSLIFMLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSI
HIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM
TLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKA
GTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAV
YAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQ
DPCTTIYVAATEPVPESVQETNSITVYASVTLPES
Download sequence
Identical sequences G3QDG9
XP_004027768.1.27298 ENSGGOP00000000287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]