SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000299 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000299
Domain Number 1 Region: 27-205
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.02e-44
Family Matrix metalloproteases, catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 261-338
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000667
Family I set domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000299   Gene: ENSGGOG00000000303   Transcript: ENSGGOT00000000305
Sequence length 342
Comment pep:known_by_projection chromosome:gorGor3.1:1:1598515:1600395:1 gene:ENSGGOG00000000303 transcript:ENSGGOT00000000305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLKGDVAALGLSAVPPTRVPGPLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPR
ETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVSALHHCFDGPTGEL
AHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQHGRAL
MHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDF
CYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGY
LALGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG
Download sequence
Identical sequences ENSGGOP00000000299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]