SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000312 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000312
Domain Number 1 Region: 8-123
Classification Level Classification E-value
Superfamily POZ domain 4.71e-29
Family BTB/POZ domain 0.000000707
Further Details:      
 
Domain Number 2 Region: 555-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 499-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-16
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 4 Region: 419-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000048
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 596-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000285
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000312   Gene: ENSGGOG00000000319   Transcript: ENSGGOT00000000320
Sequence length 673
Comment pep:known_by_projection chromosome:gorGor3.1:11:111902903:112100994:1 gene:ENSGGOG00000000319 transcript:ENSGGOT00000000320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQLPPPAEAGQAPTGRPEHPAPLPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
Download sequence
Identical sequences G1R6V8 G3QDJ1
ENSNLEP00000008930 ENSGGOP00000000312 XP_003253213.1.23891 XP_004052206.1.27298 XP_012351466.1.23891 ENSNLEP00000008930 ENSGGOP00000000312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]