SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000318 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000318
Domain Number 1 Region: 10-124
Classification Level Classification E-value
Superfamily POZ domain 8.11e-31
Family BTB/POZ domain 0.00094
Further Details:      
 
Domain Number 2 Region: 397-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000021
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 376-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000018
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000318   Gene: ENSGGOG00000000324   Transcript: ENSGGOT00000000326
Sequence length 505
Comment pep:known_by_projection chromosome:gorGor3.1:1:153165907:153183987:1 gene:ENSGGOG00000000324 transcript:ENSGGOT00000000326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTMEKGGNIQLEIPDFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFR
DHMSLNEMSTVSISVIKNPTVFEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIIDKC
TQILEGIHFKINVAEVEAELSQTRTKHQERPPESHRVTPNLNRSLSPRHNTPKGNRRGQV
SAVLDIRELSPPEESTSPQIIEPSSDVESREPILRINRAGQWYVETGVADRGGRSDDEVR
VLGAVHIKTENLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSVGQENYTLGSSGAKV
ARPTSSEVDRFSPSGSVVPLTERHRARSESPGRMDEPKQPSSQVEESAMMGVSGYVEYLR
EQEVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEY
HIRKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGCIPLEGPHSISPETTVTSRGQAEE
ESPSQEETVAPGEAVQGSVSTTGPD
Download sequence
Identical sequences ENSGGOP00000000318 ENSGGOP00000000318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]