SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000386 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000386
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily POZ domain 2.86e-29
Family BTB/POZ domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000386   Gene: ENSGGOG00000000393   Transcript: ENSGGOT00000000395
Sequence length 424
Comment pep:known_by_projection chromosome:gorGor3.1:9:119682989:119722079:-1 gene:ENSGGOG00000000393 transcript:ENSGGOT00000000395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFS
GNSKSAFELPGSVPPACFQQILSFCYTGRLTMTASEQLVVMYTAGFLQIQHIVERGTDLM
FKVSSPHCQEKPEPVPLESRSCVLIRRDLVALPASLISQIGYRCHPKLYSEGDPGEKLEL
VAGSGVYITRGQLMNCHLCAGVKHKVLLRRLLATFFDRNTLANSCGTGIRSSTSDPSRKP
LDSRVLNAVKLYCQNFAPSFKESEMNVIAADMCTNARRVRKRWLPKIKSMLPEGVEMYRT
VMGSSAASVPLDPEFPPAAAQVFEQRIYTERRGDAATIVALRTDAVNVDLSAAANPAFDA
GEEVDGAGSVIQEVAAPEPPPXXXXPADGQSPPQPFEQGGGGPSRPQTPAAAARRPEGTY
AGTL
Download sequence
Identical sequences ENSGGOP00000000386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]