SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000450 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000450
Domain Number 1 Region: 26-483
Classification Level Classification E-value
Superfamily Sema domain 1.31e-161
Family Sema domain 0.000000000000029
Further Details:      
 
Domain Number 2 Region: 485-536
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000615
Family Plexin repeat 0.0000445
Further Details:      
 
Domain Number 3 Region: 594-676
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000291
Family C1 set domains (antibody constant domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000450   Gene: ENSGGOG00000003083   Transcript: ENSGGOT00000000459
Sequence length 721
Comment pep:known_by_projection chromosome:gorGor3.1:9:71283944:71378036:-1 gene:ENSGGOG00000003083 transcript:ENSGGOT00000000459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMCNPIRGLLMALAVMFGTAMAFAPIPRITWEHREVRLVQFHEPDIYNYSALLLSEDKD
TLYIGAREAVFAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSA
TSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTEVSV
EYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSGLVFNVLRDVFVLR
SPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQSHTKWVRYNG
PVPKPRPGACIDSEARAKDHPLMDDSVTPIDNRPRLIKKDVNYTQIVVDQTQALDGTVYD
VMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSSKKGSRFVYAGSNSGVVQ
APLAFCGKHGTCEDCVLARDPYCAWSPSTATCVALHQTESPSRGLIQEMSGDASVCPASS
PKPLPPPGSSSLSCLGHVGDRRLSSPWTPWPASGAGPDSSSRVSLLPPFLSDQAQHVHAL
GNFYLFCQATGPADIRFVWEKNGQALETCVPVQTHALPDGRAHALSWLQDAIRESAEYRC
SVLSSAGNKTSKVQVAVMRPEVTHQEKWTRELSAWRAVAGEHDRMMQSWRKAWESCSKDT
L
Download sequence
Identical sequences ENSGGOP00000000450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]