SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000458 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000458
Domain Number 1 Region: 301-358
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000105
Family ATI-like 0.047
Further Details:      
 
Domain Number 2 Region: 660-722
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000113
Family ATI-like 0.089
Further Details:      
 
Domain Number 3 Region: 768-829
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000157
Family ATI-like 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000458
Domain Number - Region: 819-868
Classification Level Classification E-value
Superfamily FnI-like domain 0.00023
Family Fibronectin type I module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000458   Gene: ENSGGOG00000000463   Transcript: ENSGGOT00000000469
Sequence length 2253
Comment pep:known_by_projection chromosome:gorGor3.1:11:974686:997472:-1 gene:ENSGGOG00000000463 transcript:ENSGGOT00000000469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQRWLLLSCFGALLSAGLANTSYTSPGLQRLKDSPQTAQDKGQCSTWGAGHFSTFDHHV
YDFSGTCNYIFAATCKDAFPTFSVQLRRGPDGSISRIIVELGASVVTVSEATISVKDIGV
ISLPYTSNGLQITPFGQSVRLVAKQLELELEVVWGPDSHLMVLVERKYMGQMCGLCGNFD
GKVTNEFVSEEGKFLEPHKFAALQKLDDPGEICTFQDIPSTHVRQAQHARICTQLLTLVA
PECSVSKEPFVLSCQADVAAAPQPGPQNSSCATLSEYSRQCSMVGQPVRRWRGPGLCSVG
QCPANQVYQECGSACLKTCSNPQHSCSSSCTFGCFCPEGTVLNDLSNNHTCVPVTQCPCV
LHGAMYAPGEVTIAACQTCRCTLGRWACTERPCPGHCSLEGGSFVTTFDARPYRFHGTCT
YILLQSPQLPENGALMAVYDKSGFSHSETTLVAVVYLSRQDKIVISQDEVVTNNGEAKWL
PYKTRNITVFRQTSTHLQMATSFGLELVVQLRPIFQAYVTVGPQFRGQTRGLCGNFNGDT
TDDFTTSVGIVEGTASLFVDSWRAGNCPAALERETDPCSMSQLNKVCAETHCSVLLRTGT
VFERCHATVNPAPFYKRCVYQACNYEETFPHICAALGDYVHACSSRGVLLWGWRSSVDNC
TIPCTGNTTFSYNSQACERTCLSLSDRATECHHSAVPVDGCNCPDGTYLNHKDECVRKAQ
CPCILEGYKFILAEQSTVINGVTCHCINGRLSCLQRAQMFLASCQAPKTFKSCSQSSENK
FGAACAPTCQMLATGVACVPTKCEPGCVCAEGLYENADGQCVPPEECPCEFSGASYPGGA
ELHTDCSTCTCSRGRWACQQGAHCPSTCTLYGEGHVITFDGQRFVFDGNCEYILATDVCG
VNDSQPTFKILTENVICGNSGVTCSRAIKIFLGGLSVVLADRNYTVTGEEPHVQLRVTPG
ALSLVVDISIPGRYNLTLIWNRHMTVLIRIARASQDPLCGLCGNFNGNMKDDFETRSRYV
ASSELEFVNSWKESPLCGDVSFVADPCSLNAFRSSWAERKCSIINSQTFAACHSKVYHLP
YYEACVRDACGCDSGGDCECLCDAVAAYAQACLDKGVCVDWRTPAFCRCYNCSQDEYFDH
EEGVCVPCMPPTTPQPPTTPQPPTTGSRPTQVWPMTGTSTTIGLLSSTGPSPSSNGTPAS
PTQTPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRA
TASTASPATTSTAQSTTRTTMTLPTPATSGTSPTLPFQTTTTYPTPSHPQTTLPTHVPPF
STSLMTPNTHTVITPTHPQMATSAYIHSTPTGTIPPPTTLKATGSTHTAPPMTPTTSGTS
QASSSFNTAKTSTSLHSHNSSTHHPEVTPTSITNITLNPTSIGTWTPVAHTTSATSSRLT
TPFTTHSPPTGSSPISSTGPVTATSFHATTTYPTPSHPHTTLPTHVPPSSTSLVTPNTHT
LITPTHAQMSTSASIHSMPTGTIPPPTTIKATGSTHTAPTMTPTTSGTSQALSSFSIAKT
STSLHSHTSSTHHPEVTPTSTTNITTKHTSTATRTPVAHTTSATSSRLTTPFTTNSPPTG
SSPISSTGPMTATSFQTTTTYPTPSHSRTTLPTHVPPSSTSLVTPNTHTLITPTHAQMST
SASIHSTSTGTIPPPTTLKATGSTHTAPPITVTTSGTSQAPSSFSTAKTSTSLHSHTSST
HHPEVTPTSTTNITPKHTSTATRTPLAHTTLTTSSRLTTPFTTHSPPTGSSPISSTAPVT
ATSFQTTTTYPTPSHSQTTLPTHIPPFSTSLVTPSTQTVITPTHAQMSTSAYIHSTPTGT
IPPPTTLKATGSTHTAPPMTVTTSGTSQTHSSFSTTTASSSFISSSSWLPQNSSSRPPSS
PITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSSVSYVPSSHSSPQTSSSSVGTFSSFV
SAPVHSTTLSSGSHSSLSTHPTTASVSASPLFPSSPAASTTIRATLPHTISSPFTLSALL
PISTLTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTSLTTRVPTSGFV
SLTSGVTGIPTSPVTKLTTRHPGPTSSPTTRFLTSSLTAHGSTPSSAPVSSLGTPTPTSP
GVCSVREQQEEITFKGCMANVTVTRCEGACISAASFNIITQQVDTRCSCCRPLHSYEQQL
ELPCPDPSTPGQRLVLTLQVFSHCVCSSVACGD
Download sequence
Identical sequences ENSGGOP00000000458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]