SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000589 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000589
Domain Number 1 Region: 11-207
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 2.22e-44
Family Isochorismatase-like hydrolases 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000589   Gene: ENSGGOG00000000598   Transcript: ENSGGOT00000000603
Sequence length 215
Comment pep:known_by_projection chromosome:gorGor3.1:19:52965825:52969016:-1 gene:ENSGGOG00000000598 transcript:ENSGGOT00000000603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARPSLGRVLPGSSILFLCDMQEKFRHNIAYFPQIVSVAARMLRVARLLEVPVMLTEQ
YPQGLGPTVPELGTEGLRPLAKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILDPRS
YPGLALTSLYPQNTTLDLLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGL
ILQLVGDAAHPQFKEIQKLIKEPAPDSGLLGLFQG
Download sequence
Identical sequences ENSGGOP00000000589 ENSGGOP00000018674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]