SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000612 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000612
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily DNA clamp 2.58e-23
Family SCOPe 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000612   Gene: ENSGGOG00000000623   Transcript: ENSGGOT00000000627
Sequence length 280
Comment pep:known_by_projection chromosome:gorGor3.1:7:49061446:49076775:-1 gene:ENSGGOG00000000623 transcript:ENSGGOT00000000627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQ
ENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELL
SMSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHL
VIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHEDRNVEHMAEVHIDIRKLLQF
LAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS
Download sequence
Identical sequences A4D2F2 H2QUJ9 O60921
GO.36619 HR6010 ENSPTRP00000032761 gi|4758576|ref|NP_004498.1| 3g65_C ENSP00000258774 ENSP00000403844 ENSP00000258774 9598.ENSPTRP00000032761 9606.ENSP00000258774 ENSP00000258774 ENSP00000403844 ENSGGOP00000000612 ENSPTRP00000032761 ENSGGOP00000000612 NP_004498.1.87134 NP_004498.1.92137 XP_003805878.1.60992 XP_004045469.1.27298 XP_008973691.1.60992 XP_008973694.1.60992 XP_008973697.1.60992 XP_016801186.1.37143 XP_016801187.1.37143 XP_016812923.1.37143 XP_519090.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]