SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000687 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000687
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.61e-34
Family MHC antigen-recognition domain 0.000017
Further Details:      
 
Domain Number 2 Region: 93-182
Classification Level Classification E-value
Superfamily Immunoglobulin 5.05e-27
Family C1 set domains (antibody constant domain-like) 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000687   Gene: ENSGGOG00000000700   Transcript: ENSGGOT00000000703
Sequence length 231
Comment pep:novel chromosome:gorGor3.1:6:33519761:33531761:-1 gene:ENSGGOG00000000700 transcript:ENSGGOT00000000703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFLEQAKCECHILNGTERVQYLNRYIHKREENLRFDSDVGEFQAVTELGRPVAEKWNSQK
EILEEKRDKVDTYCRYSYGVFESFTVPRVQPKVTVYPSKTQLLQHHNLLVCSVSGFYPGS
IEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTV
EWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRSQKGHSGLQPTGFLS
Download sequence
Identical sequences ENSGGOP00000000687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]