SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000731 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000731
Domain Number 1 Region: 229-334
Classification Level Classification E-value
Superfamily Immunoglobulin 3.95e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 33-122
Classification Level Classification E-value
Superfamily Immunoglobulin 3.6e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 165-227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000182
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000731   Gene: ENSGGOG00000000742   Transcript: ENSGGOT00000000747
Sequence length 398
Comment pep:known_by_projection chromosome:gorGor3.1:15:53114281:53499590:-1 gene:ENSGGOG00000000742 transcript:ENSGGOT00000000747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEGSLLAPALALSMLALSRALLPGPGPEQLAGFVKSPMSETKLTGDAFELYCDVVGSPTP
EIQWWYAEVNRAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASN
DPKRNDLRQNPSITWIRAQATISVLQKPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLT
YSYWTKNGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDI
TGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTEL
NIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVY
EKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN
Download sequence
Identical sequences ENSGGOP00000000731 ENSGGOP00000000731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]