SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000824 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000824
Domain Number 1 Region: 113-214
Classification Level Classification E-value
Superfamily Fibronectin type III 9.54e-36
Family Fibronectin type III 0.000000915
Further Details:      
 
Domain Number 2 Region: 215-309
Classification Level Classification E-value
Superfamily Fibronectin type III 3.33e-18
Family Fibronectin type III 0.000000968
Further Details:      
 
Domain Number 3 Region: 34-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000414
Family I set domains 0.0000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000824   Gene: ENSGGOG00000000836   Transcript: ENSGGOT00000000842
Sequence length 468
Comment pep:known_by_projection chromosome:gorGor3.1:1:133401437:133462625:1 gene:ENSGGOG00000000836 transcript:ENSGGOT00000000842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAVGCALLAALLAAPGAALAPRRCPAQEVARDVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGHPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPTQALTTNKDDDNILFRDSANATSLPVQDSS
SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Download sequence
Identical sequences ENSGGOP00000000824 ENSGGOP00000000824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]