SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000911 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000911
Domain Number 1 Region: 53-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 2 Region: 125-167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000911   Gene: ENSGGOG00000000923   Transcript: ENSGGOT00000000930
Sequence length 282
Comment pep:known_by_projection chromosome:gorGor3.1:19:8523667:8529922:-1 gene:ENSGGOG00000000923 transcript:ENSGGOT00000000930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGGWMARVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQ
CRTSGLCVPLTWRCDRDMDCSDGSDEEECRIEPCTQNGQCPPPPGLPCPCTGVSDCSGGT
DKKLRNCSRLACPAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATT
MGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSA
SLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
Download sequence
Identical sequences ENSGGOP00000000911 ENSGGOP00000000911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]