SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000939 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000939
Domain Number 1 Region: 37-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000881
Family I set domains 0.079
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000939
Domain Number - Region: 146-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00253
Family C1 set domains (antibody constant domain-like) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000939   Gene: ENSGGOG00000000953   Transcript: ENSGGOT00000000960
Sequence length 366
Comment pep:known_by_projection chromosome:gorGor3.1:11:116465939:116468717:1 gene:ENSGGOG00000000953 transcript:ENSGGOT00000000960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGT
PRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPSSGRSANA
SVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFL
VLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGLLATRVEVPLLGIIV
AAGLALGTLVGFSTLVACLVCRKEKKTKGPSRRPSLISSDSNNLKLNNVRLPRENMSLPS
NLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSRGFIRLPMLGYIYRVSSVS
SDEIWL
Download sequence
Identical sequences G3RVV3
XP_004052276.1.27298 XP_018891765.1.27298 ENSGGOP00000000939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]