SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001060 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001060
Domain Number 1 Region: 595-801
Classification Level Classification E-value
Superfamily Fibronectin type III 1.97e-31
Family Fibronectin type III 0.00046
Further Details:      
 
Domain Number 2 Region: 803-988
Classification Level Classification E-value
Superfamily Fibronectin type III 1.2e-27
Family Fibronectin type III 0.0000219
Further Details:      
 
Domain Number 3 Region: 416-502
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-22
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 315-403
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-20
Family I set domains 0.00056
Further Details:      
 
Domain Number 5 Region: 224-310
Classification Level Classification E-value
Superfamily Immunoglobulin 9.2e-20
Family I set domains 0.0026
Further Details:      
 
Domain Number 6 Region: 497-601
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-17
Family I set domains 0.05
Further Details:      
 
Domain Number 7 Region: 24-116
Classification Level Classification E-value
Superfamily Immunoglobulin 5.04e-17
Family I set domains 0.00039
Further Details:      
 
Domain Number 8 Region: 124-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000577
Family I set domains 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001060   Gene: ENSGGOG00000001075   Transcript: ENSGGOT00000001084
Sequence length 1026
Comment pep:known_by_projection chromosome:gorGor3.1:3:2659945:3170407:1 gene:ENSGGOG00000001075 transcript:ENSGGOT00000001084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPWELLVLQSFMLCLADDSTLHGPIFIQEPSPVMFPLDSEEKKVKLNCEVKGNPKPHI
RWKLNGTDVDTGMDFRYSVVEGSLLINNPNTTQDAGTYQCTATNSFGTIVSREAKLQFAY
LDNFKTRTRSTVSVRRGQGMVLLCGPPPHSGELSYAWIFNEYPSYQDNRRFVSQETGNLY
IAKVEKSDVGNYTCVVTNTVTNHKVLGPPTPLILRNDGVMGEYEPKIEVQFPETVPTAKG
ATVKLECFALGNPVPTIIWRRADGKPIARKARRHKSNGILEIPNFQQEDAGLYECVAENS
RGKNVARGQLTFYAQPNWIQKINDIHVAIEENVFWECKANGRPKPTYRWLKNGEPLLTQD
RIQIEQGTLNITIVNLSDAGMYQCLAENKHGVIFSNAELSVIAVGPDFSRTLLKRVTLVK
VGGEVVIECKPKASPKPVYTWKKGRGILKENERITISEDGNLRIINVTKSDAGSYTCIAT
NHFGTASSTGNLVVKDPTRVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWSFNGHLI
DFDRDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPP
EAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPFSVGWQAVSTVPELIDGKTFTAT
VVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTPANVSGGGGSKSELVITW
ETVPEELQNGRGFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVF
NNKGEGPFSPTTVVYSAEEEPTKPPASIFARSISATDIEVFWASPLEKNRGRIQGYEVKY
WRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPP
PSQPPGNIIWNSSDSKIILNWDQVKALDNESEVKGYKVLYRWNRQSSTSVIETNKTSVEL
SLPFDEDYIIEIKPFSDGGDGSSSEQIRIPKISNAYARGSGASTSNACTLSAISTIMISL
TARSSL
Download sequence
Identical sequences G3QFI7
ENSGGOP00000001060 XP_018880309.1.27298 ENSGGOP00000001060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]