SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001092 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001092
Domain Number 1 Region: 33-575
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 5.62e-160
Family Aconitase iron-sulfur domain 0.00000000000000389
Further Details:      
 
Domain Number 2 Region: 582-800
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 6.87e-63
Family LeuD-like 0.00000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001092   Gene: ENSGGOG00000001107   Transcript: ENSGGOT00000001116
Sequence length 804
Comment pep:known_by_projection chromosome:gorGor3.1:22:25826957:25884248:1 gene:ENSGGOG00000001107 transcript:ENSGGOT00000001116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLN
RPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAV
PSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILEN
YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG
WSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGEEGGQATWPLPCAGPDGSPVG
SRSGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGREDIANLADEFKDHLVPDPGCHYD
QLIEINLSELKPHINGPFTPDLAHPVAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGR
SAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDLGGIVLANACGPCIGQW
DRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDYLM
GTDGKKFRLEAPDADELPKAEFDPGQDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWD
GKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNA
VTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIH
ETNLKKQGLLPLTFADPDYNKIHPVDKLTIQGLKDFTPGKPLKCIIKHPNGTQETILLNH
TFNETQIEWFRAGSALNRMKELQQ
Download sequence
Identical sequences ENSGGOP00000001092 ENSGGOP00000001092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]