SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001132 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001132
Domain Number 1 Region: 87-234,480-593,642-745
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.63e-56
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 
Domain Number 2 Region: 199-324,360-442
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000513
Family WD40-repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001132   Gene: ENSGGOG00000001147   Transcript: ENSGGOT00000001156
Sequence length 1523
Comment pep:known_by_projection chromosome:gorGor3.1:19:33357211:33414423:1 gene:ENSGGOG00000001147 transcript:ENSGGOT00000001156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVGSGGYARNDAGEKLPSVMAGVPARRGQSSPPPAPPLCLRRRTRLSTASEETVQNRV
SLEKVLGITAQNSSGLTCDPGAGHVAYLAGCVVVILDPKENKQQHIFNTARKSLSALAFS
PDGKYIVTGENGHRPAVRIWDVEEKNQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTETKVTSTVPL
VGRSGILGELHNNIFCGVACGRGRMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSQEFIFCGCTDGIVRIFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFHRKAEAVYP
DTVALTFDPIHQWLSCVYKDHSIYIWDVKDINKVGKVWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRFWNLDSSPDSHWQKNIFSNTLLKVVYVENDIQHLQDMSHFPD
RGSENGTPMDVKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVKVEAHDAEVLCL
EYSKPETGLTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGNRDIQMISCG
ADKSIYFRSAQQGSDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVNG
KQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECIAKMFGHSEIITS
MKFTYDCHHLITVSGDSCVFIWHLGPEITNCMKQHLLEIDHRQQQQHTKDKKRSGHPRQD
TYVSTPSEIRSLSPGEQTEDDLEEECEPEEMLKTPSKDSLDPDPRCLLTNGKLPLWAKRL
LGDDDVADGSAFHAKRSYQPHGRWAERAGQEPLKTILDAQDLDCYFTPMKPESLENSILD
SLEPQSLASLLSESESPQEAGRGHPSFLPQQKESSEASELILYSLEAEVTVTGTDSQYCR
KEVEAGPGDQQGDSYLRVSSDSPKDQSPPEDSGESEADLECSFSAIHSPAPPPDPAPRFA
TSLPHFPGCAGPTEDELSLPEGPSVPSSSLPQTPEQEKFLRHHFETLTESPCRELFPAAL
GDTEASEAEDYFFNPRLSISTQFLSSLQKASRFTHTFPPRATQCLVKSPEVKLMDRGGSQ
PRAGTGYASQDRTHVLAAGKAEETLEAWRLPPPCLTSLVSCVPASSVLSTDRKLPTPTSA
PTPGLAQGVHAPSTCSYMEATASSRARISRSISLGDSEGPIVATLAQPLRRPSSVGELAS
LGQELQAITTATTPSLDSEGQEPALRSWGNHEARANLRLTLSSVCDGLLLPPVDAQPGVT
VPAVSFPAPSPVEESALRLHGSAFRPSLPAPESPGLPAHPSNPQLPEAGPGVPGGTASLL
EPTSGALGLFQGSPARWSEPWVPVEALPPSPLELSRVGNILHRLQTTFQEALDLYRVLVS
SGQVDTGQQQARTELVSTFLWIHSQLEAECLVGTSVAPAQALPSPGPPSPPTLYPLASPD
LQALLEHYSELLVQAVRRKARGH
Download sequence
Identical sequences ENSGGOP00000001132 ENSGGOP00000001132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]