SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001218 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001218
Domain Number 1 Region: 40-121
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 7.88e-28
Family MHC antigen-recognition domain 0.00014
Further Details:      
 
Domain Number 2 Region: 123-217
Classification Level Classification E-value
Superfamily Immunoglobulin 5.21e-24
Family C1 set domains (antibody constant domain-like) 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001218   Gene: ENSGGOG00000013625   Transcript: ENSGGOT00000001242
Sequence length 267
Comment pep:known_by_projection chromosome:gorGor3.1:6:34023586:34032188:-1 gene:ENSGGOG00000013625 transcript:ENSGGOT00000001242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INYRPYNMRPEDRMLHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAMFVQTHRPTGEF
MFEFDEDEMFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNITIQCSNHTQA
ANDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGEPVTEGVAESLFLPRTD
YSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLG
LVGIIVGTVLIIKSLRSGRDPRAQGPL
Download sequence
Identical sequences ENSGGOP00000001218 ENSGGOP00000001218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]