SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001225 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001225
Domain Number 1 Region: 169-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000795
Family I set domains 0.047
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001225
Domain Number - Region: 114-173
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0233
Family AN1-like Zinc finger 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001225   Gene: ENSGGOG00000001242   Transcript: ENSGGOT00000001249
Sequence length 350
Comment pep:known_by_projection chromosome:gorGor3.1:19:46028371:46034421:-1 gene:ENSGGOG00000001242 transcript:ENSGGOT00000001249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPHFTLLCAALAGCLLPAEGCVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENA
VKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKE
TFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMIL
DCELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNS
SPATIINFHVTVLPKMIKEEKPSPNIVTPGEATTESSITLQPLKPEKMLASRLLGLLICG
SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPEEKATDSRQQ
Download sequence
Identical sequences ENSGGOP00000001225 ENSGGOP00000001225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]