SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001272 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001272
Domain Number 1 Region: 186-278
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000134
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 95-183
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000239
Family I set domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001272   Gene: ENSGGOG00000001288   Transcript: ENSGGOT00000001297
Sequence length 376
Comment pep:known_by_projection chromosome:gorGor3.1:1:140798059:140805519:1 gene:ENSGGOG00000001288 transcript:ENSGGOT00000001297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKKISVGVAGDLNTVTMKLGCVLMAWALYLSLGVLWVAQMLLAASFETLQCEGPVCTEE
SSCHTEDDLTDAREAGFQVKAYTFSEPFHLIVSYDWLILQGPAKPVFEGDLLVLRCQAWQ
DWPLTQVTFYRDGSALGPPGPNREFSIAVVQKADSGHYHCSGIFQSPGPGIPETASVVAI
TVQELFPAPILRAVPSAEPQAGGPMTLSCQTKLPLQRSAAHLLFSFYKDGRIVQSRGLSS
EFQIPTASEDHSGSYWCEAATEDNQVWKQSPQLEIRVQGAPSSAAPPTLNPAPQKSAAPG
TAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLVLKHMQDVRVLLGHLLMELR
ELSGHRKPGTTKATAE
Download sequence
Identical sequences G3QG22
XP_004027827.1.27298 ENSGGOP00000001272 ENSGGOP00000001272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]