SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001273 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001273
Domain Number 1 Region: 46-184
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 9.29e-47
Family Molybdopterin synthase subunit MoaE 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001273   Gene: ENSGGOG00000001290   Transcript: ENSGGOT00000001298
Sequence length 188
Comment pep:known_by_projection chromosome:gorGor3.1:17:44136033:44147743:1 gene:ENSGGOG00000001290 transcript:ENSGGOT00000001298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISSSCFNLETKLPLSPRLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVS
QLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNK
ECFWASNS
Download sequence
Identical sequences G3QG23
ENSGGOP00000001273 XP_003827400.1.60992 XP_003827401.1.60992 XP_004058914.1.27298 XP_004058915.1.27298 ENSGGOP00000001273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]