SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001287 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001287
Domain Number 1 Region: 470-560
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000131
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 284-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000696
Family V set domains (antibody variable domain-like) 0.086
Further Details:      
 
Domain Number 3 Region: 377-467
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000075
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 756-846
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000981
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 101-186
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000268
Family I set domains 0.007
Further Details:      
 
Domain Number 6 Region: 563-659
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000806
Family V set domains (antibody variable domain-like) 0.088
Further Details:      
 
Domain Number 7 Region: 663-752
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000113
Family I set domains 0.05
Further Details:      
 
Domain Number 8 Region: 200-280
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000251
Family I set domains 0.036
Further Details:      
 
Domain Number 9 Region: 21-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000778
Family I set domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001287   Gene: ENSGGOG00000001302   Transcript: ENSGGOT00000001312
Sequence length 984
Comment pep:known_by_projection chromosome:gorGor3.1:1:136515584:136554540:-1 gene:ENSGGOG00000001302 transcript:ENSGGOT00000001312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWVILLVLAPVSGQFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHQ
YLGKEILRETPDNTLEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVV
LRCRAKVEVTLNNTIYKNDNVLAFLNKRTDFRIPHARLKDNGAYRCTGYKESCCPVSSNT
VKIQVQEPFTRPVLRASSFQPISGSPVTLTCETQLSPERSDVPLRFHFFRDDQTLGLGWS
LSPKFQITAMWSKDSGFYWCKAATMPYSIISDSPRSWIQVQIPASHPVLTLSPEKALNFE
GTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNG
LGAKPSKAVSLSVTVPVSHPVLNLSSAEDLIFEGAKVTLHCEAQRGSLPILYQFHHEDAA
LERRSANSAGGVAISFSLTAEHSGNYYCTADNGFGPQRSKAVSLSVTVPVSRPVLSLRSP
EALTFEGATVTLHCEVQRGSPRILYQFYHEDMPLWSSSTTSVGRVSFSFSLTEGHSGNYY
CTADNGFGPQRSEVVSLFVTVPVSRPILTLRVPRAQAVVGDLLELHCEAPRGSPPILYWF
YHPQSCTGFEDVTLGSSSAPSGGEASFNLSLTAEHSGNYSCEANNGLVAQHSDTISLSVI
VPVSRPILTFRAARAQAVVGDWLELHCEALRGSSPILYWFYHEDVTLGKISAPSGGGASF
NLSLTTEHSGIYSCEADNGLEAQRSEMVTLKVAVPVSRPVLTLRAPGAHAAVGGLLELHC
EALRGSPLILYRFFHEDVTLGNSSSPSGGASFNLSLTAEHSGNYSCEADNGLGAQRSETV
TLYITGLTANRSGPFATGVAGGLLSIAGLAAGALLLYCWLSRKAGRKPASDPARSPSDSD
SQEPTYHNVPAWEELQPVYTNANPRGENVVYSEVRIIQEKKKHAVASDPRHLRNKGSPII
YSEVKVASTPVSGSLFLASSAPHR
Download sequence
Identical sequences ENSGGOP00000001287 ENSGGOP00000001287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]