SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001353 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001353
Domain Number 1 Region: 24-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000233
Family C1 set domains (antibody constant domain-like) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001353   Gene: ENSGGOG00000001370   Transcript: ENSGGOT00000001378
Sequence length 281
Comment pep:known_by_projection chromosome:gorGor3.1:6:44176697:44187271:1 gene:ENSGGOG00000001370 transcript:ENSGGOT00000001378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTWLLLLLALGCPALPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSP
IWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRST
QPVQLSGEASTARTCPREPLRGTPGGALWLGVLRLLLFKLLLFDLLLTCSCLRDPAGPPP
SPATTTCLQALGSHRLHLATETGGREATSSPRPQPRDHRWGDTPPGRKPGSPVWGEGSYL
SSYPTCPARAWCSRSALRTPSSSLGAFFAGDLPPPLQAGAA
Download sequence
Identical sequences ENSGGOP00000001353 ENSGGOP00000001353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]