SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001364 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001364
Domain Number 1 Region: 40-258
Classification Level Classification E-value
Superfamily L domain-like 8.16e-34
Family Ngr ectodomain-like 0.013
Further Details:      
 
Domain Number 2 Region: 253-329
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000133
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001364   Gene: ENSGGOG00000001382   Transcript: ENSGGOT00000001389
Sequence length 329
Comment pep:known_by_projection chromosome:gorGor3.1:4:119238715:119263087:1 gene:ENSGGOG00000001382 transcript:ENSGGOT00000001389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPRLNYFTLSIFLRCSGVGCLCPSQCACDYHGRNDGSGSRLVLCNDMDMNELPTNLPVDT
VKLRIEKTVIRRISAEAFYYLVELQYLWVTYNSVASIDPSSFYNLKQLHELRLDGNSLAA
FPWASLLDMPLLRTLDLHNNKITSVPNEALRYLKNLAYLDLSSNRLTTLPPDFPESWSHL
VTTPSGVLDLSPSRIILGLQDNPWFCDCHISKMIELSKVVDPAIVLLDPLMTCSEPERLT
GILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQLTWTRSDSSPVNYTV
IQESPEEGVRWSIMSLTGISSKDAGDYKC
Download sequence
Identical sequences ENSGGOP00000001364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]