SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001412 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001412
Domain Number 1 Region: 22-138
Classification Level Classification E-value
Superfamily Immunoglobulin 6.09e-25
Family V set domains (antibody variable domain-like) 0.000000982
Further Details:      
 
Domain Number 2 Region: 155-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000134
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001412   Gene: ENSGGOG00000001428   Transcript: ENSGGOT00000001438
Sequence length 366
Comment pep:novel chromosome:gorGor3.1:21:5842885:5863485:1 gene:ENSGGOG00000001428 transcript:ENSGGOT00000001438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAYSKCLVPCTFLSLDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLI
SPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQ
CKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLS
DSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLI
AGAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNH
SSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQS
KDGSIV
Download sequence
Identical sequences ENSGGOP00000001412 ENSGGOP00000001412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]