SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001434 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000001434
Domain Number - Region: 109-166
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00157
Family VPS37 C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001434   Gene: ENSGGOG00000001451   Transcript: ENSGGOT00000001461
Sequence length 251
Comment pep:known_by_projection chromosome:gorGor3.1:7:70670164:70674422:1 gene:ENSGGOG00000001451 transcript:ENSGGOT00000001461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLAS
NYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHCALGWLQ
AELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERSAQ
PAPTSAADPPKSFPAAAVLPTGAARGPPAVPRSLPPLDSRPVPPLKGSPGCPLGPAPLLS
PRPSQPEPPHR
Download sequence
Identical sequences A0A096N4K3 A0A0D9S005 A0A2I3SYZ7 A0A2J8XV00 A0A2K5RYC7 G3QGH6 I0FPI3 Q86XT2
NP_001071089.1.87134 NP_001071089.1.92137 XP_004045609.1.27298 XP_008016535.1.81039 XP_009451595.1.37143 XP_014988810.1.72884 XP_016800781.1.37143 XP_017388913.1.71028 ENSGGOP00000001434 ENSPANP00000007321 9606.ENSP00000320416 ENSP00000320416 ENSP00000461461 ENSPTRP00000032946 ENSP00000320416 ENSGGOP00000001434 ENSPTRP00000032946 ENSP00000320416 ENSP00000458873 gi|117938318|ref|NP_001071089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]