SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001452 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001452
Domain Number 1 Region: 30-132
Classification Level Classification E-value
Superfamily Immunoglobulin 1.84e-16
Family V set domains (antibody variable domain-like) 0.00000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001452   Gene: ENSGGOG00000001471   Transcript: ENSGGOT00000001479
Sequence length 276
Comment pep:known_by_projection chromosome:gorGor3.1:6:42534004:42549021:1 gene:ENSGGOG00000001471 transcript:ENSGGOT00000001479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWRAPHPLLLLLLLFPGSQARSKAQLLQSVAGQTLTVRCQYPPTGRLYEKKGWCKEASA
LVCIRLVTSSKPRTVARTSRFAIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVS
KSVRFYLVVSPASASTQTSWIPRDLVSSQTQTQSCMPPTGGPRQAPESPSTITVPSQPQN
STLRPGPAAPSALVPVLCGLLVAKSLVLSALLVWWGDIWWKTMMELRSLYTKKATCHLQQ
VTDLPWTSVSSTVEREILYHTVARTTISDDDDEHTL
Download sequence
Identical sequences G3QGJ3
ENSGGOP00000001452 XP_004044035.1.27298 ENSGGOP00000001452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]