SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001458 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000001458
Domain Number - Region: 284-334
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0405
Family Frizzled cysteine-rich domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001458   Gene: ENSGGOG00000001475   Transcript: ENSGGOT00000001485
Sequence length 597
Comment pep:known_by_projection chromosome:gorGor3.1:2b:129890664:129907485:1 gene:ENSGGOG00000001475 transcript:ENSGGOT00000001485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APVRLRRCPGWLRPESPARPADRSPPSPPAGFSPPASPSARPRSAAFPRPEHLHPEPARR
PEPLEPPLRRGSRVRRRAGSQARGPLPRRHRTRIREHLRICPQGYTCCTSEMEENLANRS
RAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAF
RDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRP
FGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLG
VPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWL
AEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEKLVSE
AKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPE
VEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGSGDGCLDDLCGR
RVGRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRWR
Download sequence
Identical sequences ENSGGOP00000001458 ENSGGOP00000001458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]