SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001510 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001510
Domain Number 1 Region: 12-363
Classification Level Classification E-value
Superfamily UROD/MetE-like 3.31e-119
Family Uroporphyrinogen decarboxylase, UROD 0.00000000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001510   Gene: ENSGGOG00000001530   Transcript: ENSGGOT00000001540
Sequence length 367
Comment pep:novel chromosome:gorGor3.1:1:46570255:46573774:1 gene:ENSGGOG00000001530 transcript:ENSGGOT00000001540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLER
LRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRW
LYQRPQASHQLLRILTDALVPYLVGQVAAGAQALQLFESHAGHLGPQLFNKFALPYIRDV
AKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVT
LQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKH
SRLLRQN
Download sequence
Identical sequences G3QGP9 H2PYW8
9598.ENSPTRP00000001156 ENSPTRP00000001156 ENSGGOP00000001510 ENSGGOP00000027252 ENSPTRP00000001156 ENSGGOP00000001510 ENSGGOP00000027252 XP_003812843.1.60992 XP_004025726.1.27298 XP_004025727.1.27298 XP_513127.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]