SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001576 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001576
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.43e-22
Family C1 set domains (antibody constant domain-like) 0.00000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001576   Gene: ENSGGOG00000001602   Transcript: ENSGGOT00000001609
Sequence length 119
Comment pep:novel chromosome:gorGor3.1:15:23464127:23486694:1 gene:ENSGGOG00000001602 transcript:ENSGGOT00000001609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWERNK
Download sequence
Identical sequences ENSGGOP00000001576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]