SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001641 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001641
Domain Number 1 Region: 169-318
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-42
Family Mannose 6-phosphate receptor domain 0.000000166
Further Details:      
 
Domain Number 2 Region: 322-466
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-41
Family Mannose 6-phosphate receptor domain 0.000000672
Further Details:      
 
Domain Number 3 Region: 626-761
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-39
Family Mannose 6-phosphate receptor domain 0.00038
Further Details:      
 
Domain Number 4 Region: 1485-1616
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.79e-37
Family Mannose 6-phosphate receptor domain 0.000000104
Further Details:      
 
Domain Number 5 Region: 1335-1476
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.06e-36
Family Mannose 6-phosphate receptor domain 0.00056
Further Details:      
 
Domain Number 6 Region: 762-923
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-33
Family Mannose 6-phosphate receptor domain 0.0012
Further Details:      
 
Domain Number 7 Region: 475-617
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-32
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 8 Region: 45-166
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.96e-31
Family Mannose 6-phosphate receptor domain 0.000000676
Further Details:      
 
Domain Number 9 Region: 1190-1332
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.31e-30
Family Mannose 6-phosphate receptor domain 0.00017
Further Details:      
 
Domain Number 10 Region: 1621-1766
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.11e-30
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 11 Region: 2102-2249
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.96e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1973-2100
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-28
Family Mannose 6-phosphate receptor domain 0.00075
Further Details:      
 
Domain Number 13 Region: 1076-1192
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.37e-24
Family Mannose 6-phosphate receptor domain 0.0046
Further Details:      
 
Domain Number 14 Region: 933-1077
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.36e-21
Family Mannose 6-phosphate receptor domain 0.0046
Further Details:      
 
Domain Number 15 Region: 1773-1866,1915-1958
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.4e-20
Family Mannose 6-phosphate receptor domain 0.0033
Further Details:      
 
Domain Number 16 Region: 1865-1914
Classification Level Classification E-value
Superfamily Kringle-like 1.97e-16
Family Fibronectin type II module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001641   Gene: ENSGGOG00000001658   Transcript: ENSGGOT00000001677
Sequence length 2461
Comment pep:known_by_projection chromosome:gorGor3.1:6:161171168:161309075:1 gene:ENSGGOG00000001658 transcript:ENSGGOT00000001677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAAGRSPHLGPVPARRPQRSLLLLQLLLLVAAPGSTQAQAAPFPELCSYTWEAVDTKN
NVLYKINICGSVDIVQCGPSSAVCMHDLKTRAYHSVGDSVLRSATRSLLEFNTTVSCDQQ
GTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFKANKEVPCYVFDEE
LRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGY
QAFDVGQPQDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSERREGTIPKL
TAKSNCRYEIEWITEYACHRDYLESKTCSLSGEQQDVSIDLTPLAQSGGSSYISDGKEYL
FYLNVCGETEIQFCNKKQAAVCQVKRSDTSQVKAAGRYHNQTLRYSDGDLTLIYFGGDEC
SSGFQRMSVINFECNKTADNDGKGSPVFTGEVDCTYFFTWDTEYACVKEKEDLLCGATDG
KKRYDLSALVRHAEPEQNWEAVDGSQTETEKKHFFINICHRVLQEGKARGCPEDAAVCAV
DKNGSKNLGKFISSPMKEKGNIQLSYSDGDDCGHGKKIKTNITLVCKPGDLESAPVLRTS
GEGGCFYEFEWHTAAACVLSKTEGENCTVFDSQAGFSFDLSPLTKKNGAYKVETKKYDFY
INVCGPVSVSPCQADSGACQVAKSDEKTWNLGLSNAKLSYYDGMIQLNYRGGTPYNNERH
TPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECVVTDPSTLEQYDL
SSLAKSEGGLGGNWYAMDNSGEHVTWRKYYINVCRPLNPVPGCNRYASACQMKYEKDQGS
FTEVVSISNLGMAKTGPVVEDSGSLLLEYVNGSACTTSDGRQTTYTTRIHLVCSRGRLNS
HPIFSLNWECVVSFLWNTEAACPIQTTTDTDQACSIRDPNSGFVFNLNPLNSSQGYNVSG
IGKIFVFNVCGTMPVCGTILGKPASGCEAETQTEELKNWKPARPVGIEKSLQLSTEGFIT
LTYKGPLSAKGTADAFIIRFVCNDDVYSGPLKFLHQDIDSGQGIRNTYFEFETALACVPS
PVDCQVTDLAGNEYDLTGLSTVRKPWTAVDTSVDGRKRTFYLSVCNPLPYIPGCHGSAVG
SCLVSEGNSWNLGVVQMSPQAAANGSLSIMYVNGDKCGNQRFSTRITFECAQISDNCEVK
DPRHGNLYDLKPLGLNDTIVSAGEYTYYFRVCGKLSSDVCPTSDESKVVSSCQEKREPQG
FHKVAGLLTQKLTYENGLLKMNFTGGDTCHKVYQRSTAIFFYCDRGTQQPVFLKETSDCS
YLFEWRTQYACPPFDLTECSFKDGAGNSFDLSSLSRYSDNWEAITGTGDPEHYLINVCKS
LAPQAGTEPCPPEAAACLLGGSKPVNLGRVRDGPQWRDGIIVLKYVDGDLCPDGIRKKST
TIRFTCSESQVNSRPMFISAVEDCEYTFAWPTATACPMKSNEHDDCQVTNPSTGHLFDLS
SLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQL
VYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEQAT
ECSVRNGSSIVDLSPLIHRTGGYEAYDESEDDASDTNPDFYINICQPLNPMHGVPCPAGA
AVCKVPIDGPPIDIGRVAGPPILNPIANEIYLNFESSTPCLADKHFNYTSLIAFHCKRGV
SMGMPKLLRTSECDFVFEWETPIVCPDEVRMDGCTLTDEQLLYSFNLSSLSTSTFKVTRD
SRTYSVGVCTFAVGPEQGGCKDGGVCLLSGTKGASFGRLQSMKLDYRHQDEAVVLSYVNG
DRCPPETDDGIPCVFPFIFNGKSYEECIIESRAKLWCSTTADYDRDHEWGFCRHSNSYRT
SSIIFKCDEDEDIGRPQVFSEVRGCDVTFEWKTKVVCPPKKLECKFVQKHKTYDLRLLSS
LTGSWSLVHDGVSYYINLCQKIYKGPLGCSERASICRRTTAGDVQVLGLVHTQKLGVIGD
KVVVTYSKGYPCGGNKTASSVIELTCTKTVGRPAFKRFDIDSCTYYFSWDSRAACAVKPQ
EVQMVNGTITNPINGKSFSLGDIYFKLFRASGDMRTNGDNYLYEIQLSSITSSRNPACSG
ANICQVKPNDQHFSRKVGTSDKTKYYLQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDP
LVEDGIPEFSHETADCQYLFSWYTSAVCPLGVGFDSENPGDDGQMHKGLSERSQAVGAVL
SLLLVALTCCLLALLLYKKERRETVISKLTTCCRRSSNVSYKYSKVNKEEETDENETEWL
MEEIQLPPPRQGKEGQENGHITTKSVKALSSLHGDDQDSEDEVLTIPEVKVHSGRGAGAE
SSHPVRNAQSNALQEREDDRVGLVRGEKARKGKSSSAQQKTVSSTKLVSFHDDSDEDLLH
I
Download sequence
Identical sequences ENSGGOP00000001641 ENSGGOP00000001641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]